PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim07g041850.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family HD-ZIP
Protein Properties Length: 681aa    MW: 76997.7 Da    PI: 6.9962
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim07g041850.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.41e-1791141656
                         S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         ++tk+q+ e+e+lF+++++p++++++eL++k++L+  q+ +WFqNrR++ k
  Sopim07g041850.0.1  91 RHTKQQIAEMEALFKECPKPDKKKIKELSDKIELEPLQIVFWFQNRRTQLK 141
                         78*********************************************9988 PP

2START124.21.6e-392184194206
                         HHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-SEEEEEEEECTT. CS
               START   4 eeaaqelvkkalaeepgWvkssesengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetlakaetlevissg. 88 
                          +a++el+++ + +ep+W      +n +e+ +kf++s+       ++ a+r+s +v+m++ +lv++++d++  W+  + ++ ++++ ++  
  Sopim07g041850.0.1 218 RAAMYELLQMSQMGEPLWLPNN-DLNIEEYKRKFPRSNDpkpngIKTSASRESSLVTMNHINLVKIFMDTN-HWTIFFSSIVLTAREMDVl 306
                         689***************9999.89999999999998889999999*************************.*******999999888867 PP

                         .EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXX CS
               START  89 .galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlkgrlp 177
                          g    ++ae+q++sp  p R  +fvR++ +  +g wvivdvS+d++   p    + R+ ++pSg++i++ sn  skvtw+eh++  + l+
  Sopim07g041850.0.1 307 dGSTKMIYAEFQVPSPQIPnRHCYFVRSCNKIVDGLWVIVDVSLDHT---P----ITRCWKRPSGCVIQQISNDISKVTWIEHIEAHDTLI 390
                         7*******************************************986...3....57********************************** PP

                         HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
               START 178 hwllrslvksglaegaktwvatlqrqcek 206
                            ++ +v+s+la+gak+w + l+rqce+
  Sopim07g041850.0.1 391 YTFYKTFVNSSLAFGAKRWISILDRQCER 419
                         ***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.42E-1677144IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-1682147IPR009057Homeodomain-like
SMARTSM003894.2E-1483147IPR001356Homeobox domain
PROSITE profilePS5007114.23683143IPR001356Homeobox domain
CDDcd000861.35E-1390143No hitNo description
PfamPF000463.3E-1591141IPR001356Homeobox domain
PROSITE profilePS5084830.68206422IPR002913START domain
SuperFamilySSF559617.83E-29210421No hitNo description
CDDcd088752.60E-77213418No hitNo description
SMARTSM002343.2E-20215419IPR002913START domain
PfamPF018521.9E-31218419IPR002913START domain
Gene3DG3DSA:3.30.530.203.4E-5282403IPR023393START-like domain
SuperFamilySSF559611.04E-12444643No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 681 aa     Download sequence    Send to blast
MDSIMNSANK NSSMIENVPS SSRLPFGQSS SMSKSKPNPI SIESETISIK EIMQLRTDDE  60
VNSKSEYNDN NVDEQDGKGD EHTNKKMCNR RHTKQQIAEM EALFKECPKP DKKKIKELSD  120
KIELEPLQIV FWFQNRRTQL KNQDQHSKNL SLRDEYDKLR TEYAWLSEVV NNGCPNCSDH  180
GFHLGEIPDN EQHLSLKNAR QEEEVVHISR QHIAEVIRAA MYELLQMSQM GEPLWLPNND  240
LNIEEYKRKF PRSNDPKPNG IKTSASRESS LVTMNHINLV KIFMDTNHWT IFFSSIVLTA  300
REMDVLDGST KMIYAEFQVP SPQIPNRHCY FVRSCNKIVD GLWVIVDVSL DHTPITRCWK  360
RPSGCVIQQI SNDISKVTWI EHIEAHDTLI YTFYKTFVNS SLAFGAKRWI SILDRQCERL  420
ASVEATNLPQ NNITHTLSID KERRKSVLKL GERMIINYIS GVSGTKTHKW TTFTGSGYNI  480
NDLQVKTRRS INDPGRPRGL VLCASTSIWL PVLPKLLFDF LRNENTRGKW DILINGGTIQ  540
EVTHIANGME IGNSISILRV NCPNQAPNGM LIIQESISDP TGSFIVYAPI DIRAIDMILC  600
GGNPDVVPLL PSGFAILPDG PSGSTNHEIS DYSGSFLTIA FQILVDNVPT ANISPQSVAA  660
VDKLMFCTIN KIKNALFLNF *
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755190.0HG975519.1 Solanum lycopersicum chromosome ch07, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010324125.10.0PREDICTED: homeobox-leucine zipper protein ROC2-like
SwissprotA2YR020.0ROC7_ORYSI; Homeobox-leucine zipper protein ROC7
TrEMBLK4CE510.0K4CE51_SOLLC; Uncharacterized protein
STRINGSolyc07g041850.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1721855
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2